Rabbit anti-Human NUP43 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04698P

• Product Name:
• Rabbit anti-Human NUP43 Polyclonal Antibody

• Synonym:
• p42; bA350J20.1; NUP43

• Description:
• The antibody against NUP43 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human NUP43 (NP_942590.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human NUP43 (NP_942590.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NUP43

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAH

• Gene ID:
• 348995

• Uniprot-ID:
• Q8NFH3

• Purification Method:
• Affinity purification

• Positive Samples:
• OVCAR3, HeLa, Rat spleen , Rat testis