Rabbit anti-Human NTPCR Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05353P

• Product Name:
• Rabbit anti-Human NTPCR Polyclonal Antibody

• Synonym:
• THEP1; C1orf57; HCR-NTPase; NTPCR

• Description:
• The antibody against NTPCR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 91-190 of human NTPCR (NP_115700.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 91-190 of human NTPCR (NP_115700.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NTPCR

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK

• Gene ID:
• 84284

• Uniprot-ID:
• Q9BSD7

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG, A-431, 293T