Rabbit anti-Human NT5C3A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02412P

• Product Name:
• Rabbit anti-Human NT5C3A Polyclonal Antibody

• Synonym:
• p36; PN-I; POMP; PSN1; UMPH; NT5C3; P5N-1; UMPH1; hUMP1; P5'N-1; cN-III; NT5C3A

• Description:
• The antibody against NT5C3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-336 of human NT5C3A (NP_001002010.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 37-336 of human NT5C3A (NP_001002010.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NT5C3A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TLKRKTGRKTKIIEMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

• Gene ID:
• 51251

• Uniprot-ID:
• Q9H0P0

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse heart