Rabbit anti-Human NSD3/WHSC1L1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13261P

• Product Name:
• Rabbit anti-Human NSD3/WHSC1L1 Polyclonal Antibody

• Synonym:
• KMT3F; KMT3G; WHISTLE; WHSC1L1; pp14328; L1

• Description:
• The antibody against NSD3/WHSC1L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-600 of human NSD3/NSD3/WHSC1L1 (NP_060248.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 400-600 of human NSD3/NSD3/WHSC1L1 (NP_060248.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NSD3/WHSC1L1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EEALSQAKKSVASKTEVKKTRRPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQDRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK

• Gene ID:
• 54904

• Uniprot-ID:
• Q9BZ95

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T