Rabbit anti-Human NR5A2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06114P

• Product Name:
• Rabbit anti-Human NR5A2 Polyclonal Antibody

• Synonym:
• B1F; CPF; FTF; B1F2; LRH1; LRH-1; FTZ-F1; hB1F-2; FTZ-F1beta; NR5A2

• Description:
• The antibody against NR5A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-541 of human NR5A2 (NP_995582.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 300-541 of human NR5A2 (NP_995582.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NR5A2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA

• Gene ID:
• 2494

• Uniprot-ID:
• O00482

• Purification Method:
• Affinity purification

• Positive Samples:
• BxPC-3, Mouse brain