Rabbit anti-Human NOX2/gp91phox Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10344P

• Product Name:
• Rabbit anti-Human NOX2/gp91phox Polyclonal Antibody

• Synonym:
• CGD; CGDX; NOX2; IMD34; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX; NOX2/gp91phox

• Description:
• The antibody against NOX2/gp91phox was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 101-200 of human NOX2/gp91phox (NP_000388.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 101-200 of human NOX2/gp91phox (NP_000388.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NOX2/gp91phox

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRS

• Gene ID:
• 1536

• Uniprot-ID:
• P04839

• Purification Method:
• Affinity purification

• Positive Samples:
• RAW 264.7