Rabbit anti-Human NOX1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09230P

• Product Name:
• Rabbit anti-Human NOX1 Polyclonal Antibody

• Synonym:
• MOX1; NOH1; NOH-1; GP91-2; NOH-1L; NOX1

• Description:
• The antibody against NOX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 418-564 of human NOX1 (NP_008983.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 418-564 of human NOX1 (NP_008983.2?).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NOX1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• WYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

• Gene ID:
• 27035

• Uniprot-ID:
• Q9Y5S8

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse liver