Rabbit anti-Human NOSIP Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-14639P

• Product Name:
• Rabbit anti-Human NOSIP Polyclonal Antibody

• Synonym:
• CGI-25; NOSIP

• Description:
• The antibody against NOSIP was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-301 of human NOSIP (NP_057037.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-301 of human NOSIP (NP_057037.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NOSIP

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA

• Gene ID:
• 51070

• Uniprot-ID:
• Q9Y314

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T