Rabbit anti-Human NME3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04274P

• Product Name:
• Rabbit anti-Human NME3 Polyclonal Antibody

• Synonym:
• NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2; NME3

• Description:
• The antibody against NME3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-169 of human NME3 (NP_002504.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-169 of human NME3 (NP_002504.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NME3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE

• Gene ID:
• 4832

• Uniprot-ID:
• Q13232

• Purification Method:
• Affinity purification

• Positive Samples:
• THP-1, Raji, Mouse kidney, Mouse liver