Rabbit anti-Human NFKB1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11411P

• Product Name:
• Rabbit anti-Human NFKB1 Polyclonal Antibody

• Synonym:
• KBF1; EBP-1; NF-kB; CVID12; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B1; NF-kappabeta; NFKB1

• Description:
• The antibody against NFKB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 41-365 of human NFKB1 (NP_001158884.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 41-365 of human NFKB1 (NP_001158884.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NFKB1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQK

• Gene ID:
• 4790

• Uniprot-ID:
• P19838

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat testis