Rabbit anti-Human NFAT2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00823P

• Product Name:
• Rabbit anti-Human NFAT2 Polyclonal Antibody

• Synonym:
• NFATC1; NF-ATC; NF-ATc1.2; NFAT2; NFATc; nuclear factor of activated T-cells 1

• Description:
• The antibody against NFAT2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 595-694 of human NFAT2(NP_001265598.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 595-694 of human NFAT2(NP_001265598.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NFAT2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLP

• Gene ID:
• 4772

• Uniprot-ID:
• O95644

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse thymus, Mouse spleen, Daudi, Ramos