Rabbit anti-Human NF-kB p65/RelA Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12753P

• Product Name:
• Rabbit anti-Human NF-kB p65/RelA Polyclonal Antibody

• Synonym:
• p65; CMCU; NFKB3; AIF3BL3; NF-kB p65/RelA

• Description:
• The antibody against NF-kB p65/RelA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-550 of human NF-kB p65/RelA (NP_068810.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 450-550 of human NF-kB p65/RelA (NP_068810.3).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NF-kB p65/RelA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS

• Gene ID:
• 5970

• Uniprot-ID:
• Q04206

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, Rat lung