Rabbit anti-Human NF-κB2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12857P

• Product Name:
• Rabbit anti-Human NF-κB2 Polyclonal Antibody

• Synonym:
• p52; p100; H2TF1; LYT10; CVID10; LYT-10; NF-kB2; p49/p100; NF-κB2

• Description:
• The antibody against NF-κB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 690-899 of human NF-κB2 (NP_002493.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 690-899 of human NF-κB2 (NP_002493.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NF-κB2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH

• Gene ID:
• 4791

• Uniprot-ID:
• Q00653

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Jurkat, H460, 293T, Mouse thymus