Rabbit anti-Human Nesprin 1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07426P

• Product Name:
• Rabbit anti-Human Nesprin 1 Polyclonal Antibody

• Synonym:
• 8B; AMC3; AMCM; CPG2; ARCA1; EDMD4; KASH1; MYNE1; Nesp1; SCAR8; C6orf98; dJ45H2.2; Nesprin 1

• Description:
• The antibody against Nesprin 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 8220-8410 of human Nesprin 1 (NP_892006.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 8220-8410 of human Nesprin 1 (NP_892006.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Nesprin 1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HDLSDRELELEDSAALSDLHWHDRSADSLLSPQPSSNLSLSLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHST

• Gene ID:
• 23345

• Uniprot-ID:
• Q8NF91

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse skeletal muscle