Rabbit anti-Human NECAB3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05008P

• Product Name:
• Rabbit anti-Human NECAB3 Polyclonal Antibody

• Synonym:
• NIP1; XB51; STIP3; EFCBP3; SYTIP2; APBA2BP; dJ63M2.4; dJ63M2.5; NECAB3

• Description:
• The antibody against NECAB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-362 of human NECAB3 (NP_112508.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-362 of human NECAB3 (NP_112508.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NECAB3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN

• Gene ID:
• 63941

• Uniprot-ID:
• Q96P71

• Purification Method:
• Affinity purification

• Positive Samples:
• LO2, Mouse liver, Rat liver