Rabbit anti-Human NDUFS6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04027P

• Product Name:
• Rabbit anti-Human NDUFS6 Polyclonal Antibody

• Synonym:
• MC1DN9; CI-13kA; CI13KDA; CI-13kD-A; NDUFS6

• Description:
• The antibody against NDUFS6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NDUFS6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

• Gene ID:
• 4726

• Uniprot-ID:
• O75380

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse kidney, Mouse liver, Mouse heart, Rat brain