Rabbit anti-Human NDUFS4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12189P

• Product Name:
• Rabbit anti-Human NDUFS4 Polyclonal Antibody

• Synonym:
• AQDQ; CI-18; MC1DN1; CI-AQDQ; CI-18 kDa; NDUFS4

• Description:
• The antibody against NDUFS4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human NDUFS4 (NP_002486.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human NDUFS4 (NP_002486.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NDUFS4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

• Gene ID:
• 4724

• Uniprot-ID:
• O43181

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, HepG2, 293T, Mouse brain, Mouse bone marrow, Mouse liver, Rat brain, Rat liver