Rabbit anti-Human NDUFB11 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11373P

• Product Name:
• Rabbit anti-Human NDUFB11 Polyclonal Antibody

• Synonym:
• ESSS; Np15; P17.3; NP17.3; CI-ESSS; MC1DN30; NDUFB11

• Description:
• The antibody against NDUFB11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human NDUFB11 (NP_061929.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human NDUFB11 (NP_061929.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NDUFB11

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRCTGCPRAWDGMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE

• Gene ID:
• 54539

• Uniprot-ID:
• Q9NX14

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, U-251MG, K-562, HeLa, Mouse liver, Mouse heart, Rat brain, Rat liver