Rabbit anti-Human NDUFA6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00910P

• Product Name:
• Rabbit anti-Human NDUFA6 Polyclonal Antibody

• Synonym:
• B14; LYRM6; CI-B14; MC1DN33; NADHB14; NDUFA6

• Description:
• The antibody against NDUFA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-154 of human NDUFA6 (NP_002481.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 35-154 of human NDUFA6 (NP_002481.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NDUFA6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

• Gene ID:
• 4700

• Uniprot-ID:
• P56556

• Purification Method:
• Affinity purification

• Positive Samples:
• Raji, HepG2, 22Rv1, Mouse kidney, Mouse heart, Rat kidney