Rabbit anti-Human NDUFA11 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12389P

• Product Name:
• Rabbit anti-Human NDUFA11 Polyclonal Antibody

• Synonym:
• B14.7; MC1DN14; CI-B14.7; NDUFA11

• Description:
• The antibody against NDUFA11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFA11 (NP_783313.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFA11 (NP_783313.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NDUFA11

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLT

• Gene ID:
• 126328

• Uniprot-ID:
• Q86Y39

• Purification Method:
• Affinity purification

• Positive Samples:
• mouse heart, mouse kidney, mouse liver