Rabbit anti-Human NCOA3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02066P

• Product Name:
• Rabbit anti-Human NCOA3 Polyclonal Antibody

• Synonym:
• ACTR; AIB1; RAC3; SRC3; pCIP; AIB-1; CTG26; SRC-3; CAGH16; KAT13B; TNRC14; TNRC16; TRAM-1; bHLHe42; NCOA3

• Description:
• The antibody against NCOA3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NCOA3 (NP_858045.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NCOA3 (NP_858045.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NCOA3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADV

• Gene ID:
• 8202

• Uniprot-ID:
• Q9Y6Q9

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa