Rabbit anti-Human NBS1/NBN Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-16964P

• Product Name:
• Rabbit anti-Human NBS1/NBN Polyclonal Antibody

• Synonym:
• ATV; NBS; P95; NBS1; AT-V1; AT-V2; BN

• Description:
• The antibody against NBS1/NBN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 520-754 of human NBS1/NBN (NP_002476.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 520-754 of human NBS1/NBN (NP_002476.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NBS1/NBN

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR

• Gene ID:
• 4683

• Uniprot-ID:
• O60934

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, Mouse testis, Rat testis