Rabbit anti-Human NAA20 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09376P

• Product Name:
• Rabbit anti-Human NAA20 Polyclonal Antibody

• Synonym:
• NAT3; NAT5; MRT73; NAT3P; NAT5P; dJ1002M8.1; NAA20

• Description:
• The antibody against NAA20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 49-178 of human NAA20 (NP_057184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 49-178 of human NAA20 (NP_057184.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NAA20

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE

• Gene ID:
• 51126

• Uniprot-ID:
• P61599

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Mouse brain, Mouse kidney, Rat brain