rabbit anti-Human N6AMT1/HEMK2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07864P

• Product Name:
• rabbit anti-Human N6AMT1/HEMK2 Polyclonal Antibody

• Synonym:
• KMT9; MTQ2; PrmC; HEMK2; N6AMT; PRED28; C21orf127; m.HsaHemK2P; N6AMT1/HEMK2

• Description:
• The antibody against N6AMT1/HEMK2 was raised in rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-214 of human N6AMT1/HEMK2 (NP_037372.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-214 of human N6AMT1/HEMK2 (NP_037372.4).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• N6AMT1/HEMK2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVVTPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

• Gene ID:
• 29104

• Uniprot-ID:
• Q9Y5N5

• Purification Method:
• Affinity purification

• Positive Samples:
• U2OS, Mouse ovary