Rabbit anti-Human N6AMT1/HEMK2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02631P

• Product Name:
• Rabbit anti-Human N6AMT1/HEMK2 Polyclonal Antibody

• Synonym:
• KMT9; MTQ2; PrmC; HEMK2; N6AMT; PRED28; C21orf127; m.HsaHemK2P; N6AMT1/HEMK2

• Description:
• The antibody against N6AMT1/HEMK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-186 of human N6AMT1/HEMK2 (NP_877426.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-186 of human N6AMT1/HEMK2 (NP_877426.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• N6AMT1/HEMK2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

• Gene ID:
• 29104

• Uniprot-ID:
• Q9Y5N5

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat kidney