Rabbit anti-Human Myeloperoxidase (MPO) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13001P

• Product Name:
• Rabbit anti-Human Myeloperoxidase (MPO) Polyclonal Antibody

• Synonym:
• MPO; Myeloperoxidase (MPO)

• Description:
• The antibody against Myeloperoxidase (MPO) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 606-745 of human Myeloperoxidase (MPO) (NP_000241.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 606-745 of human Myeloperoxidase (MPO) (NP_000241.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Myeloperoxidase (MPO)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS

• Gene ID:
• 4353

• Uniprot-ID:
• P05164

• Purification Method:
• Affinity purification