Rabbit anti-Human Myelin Protein Zero (MPZ) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04543P

• Product Name:
• Rabbit anti-Human Myelin Protein Zero (MPZ) Polyclonal Antibody

• Synonym:
• P0; CHM; DSS; MPP; CHN2; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3; CMTDID; HMSNIB; Myelin Protein Zero (MPZ)

• Description:
• The antibody against Myelin Protein Zero (MPZ) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-153 of human Myelin Protein Zero (MPZ) (NP_000521.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 30-153 of human Myelin Protein Zero (MPZ) (NP_000521.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Myelin Protein Zero (MPZ)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTR

• Gene ID:
• 4359

• Uniprot-ID:
• P25189

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse spinal cord, Rat brain, PC-12