Rabbit anti-Human Musashi-2 (MSI2) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06814P

• Product Name:
• Rabbit anti-Human Musashi-2 (MSI2) Polyclonal Antibody

• Synonym:
• MSI2H; Musashi-2 (MSI2)

• Description:
• The antibody against Musashi-2 (MSI2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Musashi-2 (Musashi-2 (MSI2)) (NP_620412.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Musashi-2 (Musashi-2 (MSI2)) (NP_620412.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Musashi-2 (MSI2)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLG

• Gene ID:
• 124540

• Uniprot-ID:
• Q96DH6

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain