Rabbit anti-Human MRPS7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07749P

• Product Name:
• Rabbit anti-Human MRPS7 Polyclonal Antibody

• Synonym:
• S7mt; MRP-S; RP-S7; RPMS7; MRP-S7; COXPD34; bMRP27a; MRPS7

• Description:
• The antibody against MRPS7 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 110-190 of human MRPS7 (NP_057055.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 110-190 of human MRPS7 (NP_057055.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPS7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITE

• Gene ID:
• 51081

• Uniprot-ID:
• Q9Y2R9

• Purification Method:
• Affinity purification

• Positive Samples:
• A549