Rabbit anti-Human MRPS35 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04774P

• Product Name:
• Rabbit anti-Human MRPS35 Polyclonal Antibody

• Synonym:
• MDS023; MRPS28; MRP-S28; HDCMD11P; MRPS35

• Description:
• The antibody against MRPS35 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human MRPS35 (NP_068593.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human MRPS35 (NP_068593.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPS35

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT

• Gene ID:
• 60488

• Uniprot-ID:
• P82673

• Purification Method:
• Affinity purification

• Positive Samples:
• HT-29, A-549, BxPC-3, A-375, Mouse heart, Mouse kidney, Mouse liver