Rabbit anti-Human MRPS18C Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00868P

• Product Name:
• Rabbit anti-Human MRPS18C Polyclonal Antibody

• Synonym:
• CGI-134; S18mt-c; MRPS18-1; mrps18-c; MRP-S18-1; MRP-S18-c; MRPS18C

• Description:
• The antibody against MRPS18C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human MRPS18C (NP_057151.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human MRPS18C (NP_057151.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPS18C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE

• Gene ID:
• 51023

• Uniprot-ID:
• Q9Y3D5

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, HepG2, 293T