Rabbit anti-Human MRPS18A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08317P

• Product Name:
• Rabbit anti-Human MRPS18A Polyclonal Antibody

• Synonym:
• mL66; S18bmt; S18mt-a; MRPS18-3; HumanS18b; MRP-S18-3; MRP-S18-a; MRPS18A

• Description:
• The antibody against MRPS18A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 97-196 of human MRPS18A(NP_060605.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 97-196 of human MRPS18A(NP_060605.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPS18A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH

• Gene ID:
• 55168

• Uniprot-ID:
• Q9NVS2

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse testis