Rabbit anti-Human MRPS14 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05011P

• Product Name:
• Rabbit anti-Human MRPS14 Polyclonal Antibody

• Synonym:
• S14mt; COXPD38; MRP-S14; HSMRPS14; DJ262D12.2; MRPS14

• Description:
• The antibody against MRPS14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPS14 (NP_071383.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPS14 (NP_071383.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPS14

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW

• Gene ID:
• 63931

• Uniprot-ID:
• O60783

• Purification Method:
• Affinity purification

• Positive Samples:
• BxPC-3, U-251MG, Mouse heart, Mouse kidney, Mouse liver