Rabbit anti-Human MRPS12 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08302P

• Product Name:
• Rabbit anti-Human MRPS12 Polyclonal Antibody

• Synonym:
• MRPS12; MPR-S12; MT-RPS12; RPMS12; RPS12; RPSM12; mitochondrial ribosomal protein S12

• Description:
• The antibody against MRPS12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 20-138 of human CYB5R3(NM_000398.7) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 20-138 of human CYB5R3(NM_000398.7).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPS12

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK

• Gene ID:
• 6183

• Uniprot-ID:
• O15235

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa