Rabbit anti-Human MRPS11 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08324P

• Product Name:
• Rabbit anti-Human MRPS11 Polyclonal Antibody

• Synonym:
• MRPS11; HCC-2; MRP-S11; S11mt; mitochondrial ribosomal protein S11

• Description:
• The antibody against MRPS11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 95-194 of human MRPS11(NP_001308899.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 95-194 of human MRPS11(NP_001308899.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPS11

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL

• Gene ID:
• 64963

• Uniprot-ID:
• P82912

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat thymus