Rabbit anti-Human MRPL42 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03252P

• Product Name:
• Rabbit anti-Human MRPL42 Polyclonal Antibody

• Synonym:
• L31MT; L42MT; S32MT; MRPL31; MRPS32; PTD007; RPML31; HSPC204; MRP-L31; MRP-L42; MRP-S32; MRPL42

• Description:
• The antibody against MRPL42 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human MRPL42 (NP_054769.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human MRPL42 (NP_054769.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPL42

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR

• Gene ID:
• 28977

• Uniprot-ID:
• Q9Y6G3

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, HeLa, Raji, HepG2, U-251MG, Mouse kidney