Rabbit anti-Human MRPL36 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08487P

• Product Name:
• Rabbit anti-Human MRPL36 Polyclonal Antibody

• Synonym:
• RPMJ; BRIP1; L36mt; bL36m; PRPL36; MRP-L36

• Description:
• The antibody against MRPL36 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 39-103 of human MRPL36(NP_115868.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 39-103 of human MRPL36(NP_115868.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPL36

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM

• Gene ID:
• 64979

• Uniprot-ID:
• Q9P0J6

• Purification Method:
• Affinity purification

• Positive Samples:
• RT4