Rabbit anti-Human MRPL30 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00231P

• Product Name:
• Rabbit anti-Human MRPL30 Polyclonal Antibody

• Synonym:
• L28MT; L30MT; MRPL28; RPML28; MRP-L28; MRP-L30; MRPL28M; MRPL30

• Description:
• The antibody against MRPL30 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human MRPL30 (NP_660213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human MRPL30 (NP_660213.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPL30

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES

• Gene ID:
• 51263

• Uniprot-ID:
• Q8TCC3

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, U-251MG, 293T