Rabbit anti-Human MRPL21 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08326P

• Product Name:
• Rabbit anti-Human MRPL21 Polyclonal Antibody

• Synonym:
• MRPL21; L21mt; MRP-L21; mitochondrial ribosomal protein L21

• Description:
• The antibody against MRPL21 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-140 of human MRPL21(NP_852615.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 40-140 of human MRPL21(NP_852615.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPL21

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NSQSTSYLPGYVPKTSLSSPPWPEVVLPDPVEETRHHAEVVKKVNEMIVTGQYGRLFAVVHFASRQWKVTSEDLILIGNELDLACGERIRLEKVLLVGADN

• Gene ID:
• 219927

• Uniprot-ID:
• Q7Z2W9

• Purification Method:
• Affinity purification