Rabbit anti-Human MRPL20 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08306P

• Product Name:
• Rabbit anti-Human MRPL20 Polyclonal Antibody

• Synonym:
• L20mt; bL20m; MRP-L20; MRPL20

• Description:
• The antibody against MRPL20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-149 of human MRPL20(NP_060441.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50-149 of human MRPL20(NP_060441.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPL20

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

• Gene ID:
• 55052

• Uniprot-ID:
• Q9BYC9

• Purification Method:
• Affinity purification

• Positive Samples:
• NIH/3T3, RAW 264.7, PC-12, HeLa, HUVEC