Rabbit anti-Human MRPL11 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08337P

• Product Name:
• Rabbit anti-Human MRPL11 Polyclonal Antibody

• Synonym:
• MRPL11; CGI-113; L11MT; MRP-L11; mitochondrial ribosomal protein L11

• Description:
• The antibody against MRPL11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 91-192 of human MRPL11(NP_057134.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 91-192 of human MRPL11(NP_057134.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPL11

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKK

• Gene ID:
• 65003

• Uniprot-ID:
• Q9Y3B7

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa,