Rabbit anti-Human MORF4L1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02702P

• Product Name:
• Rabbit anti-Human MORF4L1 Polyclonal Antibody

• Synonym:
• Eaf3; MEAF3; MRG15; FWP006; S863-6; HsT17725; MORFRG15; MORF4L1

• Description:
• The antibody against MORF4L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MORF4L1 (NP_006782.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MORF4L1 (NP_006782.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MORF4L1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG

• Gene ID:
• 10933

• Uniprot-ID:
• Q9UBU8

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF-7, HepG2, THP-1, Mouse brain, Mouse spleen, Mouse testis, Rat brain