Rabbit anti-Human MLST8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00025P

• Product Name:
• Rabbit anti-Human MLST8 Polyclonal Antibody

• Synonym:
• GBL; LST8; POP3; WAT1; GbetaL; [KD Validated] MLST8

• Description:
• The antibody against MLST8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human MLST8 (NP_001186103.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human MLST8 (NP_001186103.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MLST8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG

• Gene ID:
• 64223

• Uniprot-ID:
• Q9BVC4

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, HeLa, K-562, 22Rv1, Mouse brain, Mouse kidney, Mouse thymus, Rat brain, Rat testis