Rabbit anti-Human MGST2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00310P

• Product Name:
• Rabbit anti-Human MGST2 Polyclonal Antibody

• Synonym:
• GST2; MGST-II; MGST2

• Description:
• The antibody against MGST2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human MGST2 (NP_002404.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human MGST2 (NP_002404.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MGST2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FRAQQNCVEFYPIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF

• Gene ID:
• 4258

• Uniprot-ID:
• Q99735

• Purification Method:
• Affinity purification

• Positive Samples:
• U-937, PC-12