Rabbit anti-Human MFGE8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08446P

• Product Name:
• Rabbit anti-Human MFGE8 Polyclonal Antibody

• Synonym:
• BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888; MFGE8

• Description:
• The antibody against MFGE8 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 231-387 of human MFGE8(NP_005919.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 231-387 of human MFGE8(NP_005919.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MFGE8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

• Gene ID:
• 4240

• Uniprot-ID:
• Q08431

• Purification Method:
• Affinity purification