Rabbit anti-Human MFF Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11012P

• Product Name:
• Rabbit anti-Human MFF Polyclonal Antibody

• Synonym:
• EMPF2; GL004; C2orf33; MFF

• Description:
• The antibody against MFF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-170 of human MFF (NP_001263990.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 15-170 of human MFF (NP_001263990.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MFF

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SRAAFPSPTAAEMAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRN

• Gene ID:
• 56947

• Uniprot-ID:
• Q9GZY8

• Purification Method:
• Affinity purification

• Positive Samples:
• LO2