Rabbit anti-Human MEF2C Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09861P

• Product Name:
• Rabbit anti-Human MEF2C Polyclonal Antibody

• Synonym:
• NEDHSIL; DEL5q14.3; C5DELq14.3; MEF2C

• Description:
• The antibody against MEF2C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-380 of human MEF2C (NP_002388.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 170-380 of human MEF2C (NP_002388.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MEF2C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACTSTHLSQSSNL

• Gene ID:
• 4208

• Uniprot-ID:
• Q06413

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat, NIH/3T3, 293T, HeLa, Mouse skeletal muscle