• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti-Human MEF2C Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-09861P
  • Product Name:
  • Rabbit anti-Human MEF2C Polyclonal Antibody
  • Synonym:
  • NEDHSIL; DEL5q14.3; C5DELq14.3; MEF2C
  • Description:
  • The antibody against MEF2C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-380 of human MEF2C (NP_002388.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 170-380 of human MEF2C (NP_002388.2).
  • Species Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG
  • Application:
  • WB, IHC-P, ELISA
  • Storage Buffer:
  • PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • MEF2C
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • LPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACTSTHLSQSSNL
  • Gene ID:
  • 4208
  • Purification Method:
  • Affinity purification
  • Positive Samples:
  • Jurkat, NIH/3T3, 293T, HeLa, Mouse skeletal muscle
  • Pre product:Rabbit anti-Human MAPRE1 Polyclonal Antibody-ADA-09860P
  • Online Inquiry

    refresh