Rabbit anti-Human MED25 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04605P

• Product Name:
• Rabbit anti-Human MED25 Polyclonal Antibody

• Synonym:
• P78; ACID1; ARC92; BVSYS; PTOV2; CMT2B2; TCBAP0758; MED25

• Description:
• The antibody against MED25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human MED25 (NP_112235.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human MED25 (NP_112235.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MED25

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGCTTENLVQQIGERGIHFSIVSPRKLPALRLLFEKAAP

• Gene ID:
• 81857

• Uniprot-ID:
• Q71SY5

• Purification Method:
• Affinity purification

• Positive Samples:
• K-562, A-549, mouse brain, rat kidney