Rabbit anti-Human MCT4/SLC16A3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11724P

• Product Name:
• Rabbit anti-Human MCT4/SLC16A3 Polyclonal Antibody

• Synonym:
• MCT3; MCT4; MCT 3; MCT 4; MCT-3; MCT-4; MCT4/SLC16A3

• Description:
• The antibody against MCT4/SLC16A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-465 of human MCT4/SLC16A3 (NP_004198.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 410-465 of human MCT4/SLC16A3 (NP_004198.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MCT4/SLC16A3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV

• Gene ID:
• 9123

• Uniprot-ID:
• O15427

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa2, U-251MG, Mouse heart, Rat skeletal muscle