Rabbit anti-Human MCM7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10958P

• Product Name:
• Rabbit anti-Human MCM7 Polyclonal Antibody

• Synonym:
• MCM2; CDC47; P85MCM; P1CDC47; PNAS146; PPP1R104; P1.1-MCM3; MCM7

• Description:
• The antibody against MCM7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human MCM7 (NP_005907.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human MCM7 (NP_005907.3).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MCM7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQG

• Gene ID:
• 4176

• Uniprot-ID:
• P33993

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, HepG2, NIH/3T3, U-87MG